PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1709
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Nin-like
Protein Properties Length: 940aa    MW: 104656 Da    PI: 6.765
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1709genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.23.3e-28601652152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+i+l++l++yFs ++kdAAk+Lgvc+T+LKr+CRq+GI+RWP+Rk++++
  Gh_D05G1709 601 AEKTITLQVLRQYFSESLKDAAKSLGVCPTTLKRTCRQHGIERWPSRKLQKV 652
                  589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.621591672IPR003035RWP-RK domain
PfamPF020426.9E-25604652IPR003035RWP-RK domain
SuperFamilySSF542775.33E-22827915No hitNo description
PROSITE profilePS5174525.483829912IPR000270PB1 domain
SMARTSM006661.8E-22829912IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.5E-21829909No hitNo description
PfamPF005646.7E-18830911IPR000270PB1 domain
CDDcd064072.34E-39831911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MEDSILLPGM QLDYMDELLL DGCWLEASPT EESDFLDPNA FFDPTFEWPT SDSNGGDLGG  60
SLFQGEDPIS FLPGNPHMNE NHSQGAHLSH NLDDVNGVSC NLHGDCMTDA SELSRRWWIG  120
PRANPGPSTS VMQRLIGALN HIKDSAKETD VLVQLWLPVN KGGRRILTTS EQPFSLDPNS  180
QRLASYRNIS VKYQFPAEED SKDMAGLPGR VFLSKVPEWT PDVRFFRSDE YHRVDHAQQH  240
GVRGTFALPV FEQGNRTCLG VIEVVMTTEK IKIKPEMESV CKALEAVNLR SFTASSTRNI  300
QACNSSYQAA LPEIKEVLKR ACETHRLPLA QTWVPCMQLG KEGCPHSTDN YFHCVSTVDD  360
ACYIAKPNIR GFHEVCSEHH LLKGQGVAGR AFMTNQPCFS TDITSFKKTE YPLAHHAKMF  420
KLHAAVAIRF RCIHTGKADF VLEFFLPADC RDPEGQKEML NSLSIILQQV CCSLRVVTNE  480
ELEEDRDMGV SEVIASLDGI PCRKELSEEQ CTYHSEKYSR ENSSWTASLT EVNQSSSTST  540
AMKLRKEKPR ATWDEKISKV KQHKKQISLR GTVEGGDSTI NKISFSSATK RKTGQKRHSK  600
AEKTITLQVL RQYFSESLKD AAKSLGVCPT TLKRTCRQHG IERWPSRKLQ KVGNSLEKLQ  660
HVIDSVQGVS GAFHISSLYP NFSELASPRS SGKSTSSASV LGLNDKPKKT TILPEGGNFV  720
SQAATSNSPS SSCSQSSSSS HSCSSGTHHP SKFNISGNGG LIIGENSGNG ELKRVTSDTK  780
LHTLSQEGLK LFPRSHSPAS VKEQLISDSI QPVVTENNSQ IAQDLDAQTQ KVKVTYGDDK  840
IHFRMQSKWR LKDLLLEITR RFNIDDISGF DLKYLDDDSE WVLLTCDADL EECIDVCRWC  900
EGNTIRLLLQ ASHHHLDRSS VLKETLVSCF LHIALAEEVQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.216990.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446359.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_012446360.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_012446362.10.0PREDICTED: protein NLP4-like isoform X1
TrEMBLA0A0D2S3Y10.0A0A0D2S3Y1_G
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein